This is a working overview of TB-500, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-08-31 and is reviewed periodically as new material appears.
The compound is most often distributed as a lyophilized powder, appearing white to off-white and forming a loose cake or fluffy solid. It is hygroscopic to some degree, so brief exposure to humid air can add water weight and complicate weighing. The peptide dissolves readily in water and in neutral aqueous buffers, and aqueous solubility is generally described as high, well above the concentrations used in typical assays. Some polar organic solvents are also usable, which matters when a concentrated stock is prepared before dilution into buffer.
Storage recommendations center on keeping the dry powder cold, dry, and dark. A freezer at -20 degrees Celsius or below is conventional, and desiccant is often included to limit moisture uptake. Once dissolved, the peptide is less stable, and solutions are typically kept frozen and thawed only once. Repeated freeze-thaw cycles are a common source of losses because they promote aggregation and adsorption to container surfaces. Working aliquots are therefore prepared in advance, and glass or low-binding plastic is usually preferred over ordinary laboratory plastic.
TB-500 is a short synthetic peptide sold under a trade name rather than a systematic chemical name. Suppliers usually describe it as a fragment of thymosin beta-4 and ship it as a lyophilised powder intended for laboratory use. Because the label is commercial, the exact sequence attributed to it is not fully consistent across catalogues, and some listings present a seven-residue peptide while others describe related fragments of similar length. It is not an approved medicine in any major jurisdiction, and it is handled as a research chemical.
Thymosin beta-4 itself is a natural peptide of 43 residues found in many cell types and body fluids. Its best-characterised function is binding and sequestering actin monomers, which influences cytoskeletal dynamics. The sequence most often associated with TB-500, LKKTETQ, corresponds to part of that actin-binding region. A different fragment, Ac-SDKP, is also derived from the same parent peptide and is studied in its own right, which is one reason discussions of thymosin fragments can become confusing. The two are structurally distinct and are not interchangeable.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized cake or fluffy solid |
| Water solubility | High | Dissolves in water and neutral buffers |
| Dry storage | -20 °C or below | Dry, dark, desiccated |
| Reconstituted storage | Frozen, single thaw | Repeated freeze-thaw promotes loss |
| Purity method | Reverse-phase HPLC | Peak area read at 214 or 220 nm |
Thymosin beta-4 contains 43 amino acids and has a reported molecular mass near 4963 Da. The short fragment most often associated with the TB-500 label, an acetylated chain beginning LKKTETQ, has a reported mass near 889 Da, so the two are easily separated in analytical work. Mass spectrometry and amino acid analysis can confirm which material is present in a given sample. Statements treating TB-500 and thymosin beta-4 as interchangeable are therefore imprecise, even though the two appear together in much of the same literature.
Interest in the compound comes largely from studies of the parent protein, which participates in actin sequestration, cell migration and tissue repair processes. Whether a short fragment reproduces those activities is a separate question that remains open in the published record. Many summaries describe mechanisms by analogy to thymosin beta-4 rather than from direct measurements on the fragment. Claims about activity should be treated as provisional unless a cited study specifies the exact peptide, its purity and the assay used.
Detection in biological samples relies on mass spectrometry, typically liquid chromatography coupled to tandem mass spectrometry after peptide extraction and enrichment. Intact peptides can also be confirmed by high-resolution mass measurement together with fragmentation data. Detection windows in urine are short because the peptide is degraded by proteases and cleared quickly, and concentrations are low. Many jurisdictions treat the compound as a prohibited substance in sport, grouped with peptide hormones and related factors, while it is not an approved therapeutic product. Identity and purity statements therefore rest on certificates of analysis, ideally issued by an independent laboratory.
Material is normally supplied as a lyophilised powder in a sealed vial. The powder is hygroscopic, so exposure to humid air leads to water uptake, caking and gradual loss of the fluffy texture that indicates a good freeze-dry. Vials are best kept sealed with desiccant, protected from light and stored cold. Letting a cold vial warm to room temperature before opening reduces condensation on the contents. Purity is normally reported from a chromatographic run, and that figure applies to the batch as tested rather than to the vial after repeated opening.
Once dissolved, the peptide is far less stable than the dry powder. Aqueous solutions are subject to hydrolysis, oxidation at susceptible residues and gradual loss of material through adsorption onto glass and plastic surfaces. Terminal glutamine can cyclise under some conditions, producing a related species that complicates purity assessment. Dilute solutions tend to lose a larger fraction of material to surfaces than concentrated ones. Buffers, pH and ionic strength all influence the rate of change, so stability figures are only meaningful when those parameters are stated alongside the storage interval.
The arachnoid mater, or arachnoid membrane, is the middle element of the meninges. Thin and transparent, its name reflects its resemblance to a spider web. Its fibrous tissue cushions the central nervous system. Like the pia mater, it has an outer layer of tightly packed flat cells, forming the arachnoid barrier. The arachnoid is loosely fitting and does not closely follow the ridges and grooves on the surface of the brain. A large number of fine filaments called arachnoid trabeculae pass from the arachnoid through the subarachnoid space to blend with the tissue of the pia mater. The arachnoid barrier creates a restrictive permeability barrier between the cerebrospinal fluid in the subarachnoid space and the blood circulation in the dura. The arachnoid barrier layer is characterized by a distinct continuous basal lamina on its inner surface toward the innermost collagenous portion of the arachnoid reticular layer.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
==== Effects on plasticity ==== Activation of group 1 mGluRs are implicated in synaptic plasticity and contribute to both neurotoxicity and neuroprotection such as protection of the retina against NMDA toxicity, mentioned above. It causes a reduction in ZENK expression, which leads to myopia in chicken.
Sources: en.wikipedia.org
== Polymer chemistry == In the context of polymers, "dimer" also refers to the degree of polymerization 2, regardless of the stoichiometry or condensation reactions. One case where this is applicable is with disaccharides. For example, cellobiose is a dimer of glucose, even though the formation reaction produces water:
This reaction is exothermic and releases sufficient heat to ignite the resulting hydrogen in the presence of oxygen. Finely powdered potassium ignites in air at room temperature. The bulk metal ignites in air if heated. Because its density is 0.89 g/cm3, burning potassium floats in water that exposes it to atmospheric oxygen. Many common fire extinguishing agents, including water, either are ineffective or make a potassium fire worse. Nitrogen, argon, sodium chloride (table salt), sodium carbonate (soda ash), and silicon dioxide (sand) are effective if they are dry. Some Class D dry powder extinguishers designed for metal fires are also effective. These agents deprive the fire of oxygen and cool the potassium metal. During storage, potassium forms peroxides and superoxides. These peroxides may react violently with organic compounds such as oils. Both peroxides and superoxides may react explosively with metallic potassium. Because potassium reacts with water vapor in the air, it is usually stored under anhydrous mineral oil or kerosene. Unlike lithium and sodium, potassium should not be stored under oil for longer than six months, unless in an inert (oxygen-free) atmosphere, or under vacuum. After prolonged storage in air dangerous shock-sensitive peroxides can form on the metal and under the lid of the container, and can detonate upon opening. Ingestion of large amounts of potassium compounds, certain drugs, and homeostatic failure, can lead to hyperkalemia, leading to a variety of brady- and tachy-arrhythmias that can be fatal. Potassium chloride is used in the U.S.
== Genetics == The enzyme is coded by the gene with the symbol MTHFR on chromosome 1 location p36.3 in humans. There are DNA sequence variants (genetic polymorphisms) associated with this gene. In 2000 a report brought the number of polymorphisms up to 24. Two of the most investigated are C677T (rs1801133) and A1298C (rs1801131) single nucleotide polymorphisms (SNPs). While multiple published studies have drawn relationships between these SNPs and a wide variety of diseases, the American College of Medical Genetics has issued an official Practice Guideline recommending against testing or reporting on these two variants, citing "Recent meta-analyses have disproven an association between hyperhomocysteinemia and risk for coronary heart disease and between MTHFR polymorphism status and risk for venous thromboembolism. There is growing evidence that MTHFR polymorphism testing has minimal clinical utility.". However, a more recent study has shown that the presence of the C677T and/or A1298C polymorphisms may have a critical impact on leukemic cell response to MYC-targeting therapies. This study demonstrates that MTHFR deficiency indeed increases leukemic cell resistance to a variety of MYC-targeting pharmacological agents, including BET protein small-molecule inhibitors.
The International Alliance for the Control of Scabies was started in 2012, and brings together over 150 researchers, clinicians, and public-health experts from more than 15 countries. It has managed to bring the global health implications of scabies to the attention of the World Health Organization (WHO). Consequently, the WHO has included scabies on its official list of neglected tropical diseases and other neglected conditions.
Sources: en.wikipedia.org
=== Early years (2007–2017) === Thechineseroom's first three projects were two mods for Half-Life 2, named Antlion Soccer and Dear Esther, and a Doom 3 mod, Conscientious Objector. The modding project was backed by the Arts and Humanities Research Council. Of these, Dear Esther became a cult hit. In 2009, Thechineseroom developed Korsakovia, which was a survival horror mod. After Korsakovia, Thechineseroom worked with Robert Briscoe to develop a remake of Dear Esther, this time as a full-fledged video game, distributed through Valve's Steam distribution service. This stand-alone version of the mod received several IGF nominations, such as the Seamus McNally Grand Prize, Excellence in Visual Arts and Audio, and the Nuovo Award. It finally won for Excellence in Visual Art. The remake featured improved graphics, but was based on the same engine as the previous mods, Source. The game was released in early 2012 and reached 50,000 copies sold within one week. In February 2012, Thechineseroom announced that they began development on Amnesia: A Machine for Pigs, a survival horror game and indirect sequel to Amnesia: The Dark Descent. This project was produced by the makers of the original game, Frictional Games. Thechineseroom also began work on their newest game, Everybody's Gone to the Rapture alongside the development of Amnesia: A Machine for Pigs. During that time, on 11 June 2013, they renamed themselves to the Chinese Room, introducing a new logo. The studio team partnered with Santa Monica Studio to produce Everybody's Gone to the Rapture.
== Efficacy == Results from a Canadian double-blind, placebo-controlled biopsy Phase III clinical trial, involving total of 549 patients with diabetic sensorimotor polyneuropathy (DSP) randomly assigned to treatment with placebo or 10, 20, or 40 mg/day ranirestat for 52 weeks, showed that ranirestat appears to have effect on motor nerve function in mild to moderate DSP, but failed to show statistically significant difference in sensory nerve function. Efficacy of ranirestat was evaluated by nerve conduction studies, the modified Toronto Clinical Neuropathy Score (mTCNS), and quantitative sensory tests (QSTs).
Liu Wencai's administration was notorious for its corruption but effective in achieving Liu Wenhui's goals, collecting 30,000 silver dollars in its first year through the enforcement of various taxes. Liu Wencai also advised his brother to appoint loyalists as county magistrates in areas under their control, ensuring local revenue flowed directly to his forces. In Yibin, Liu Wenhui promoted modern education in both the military and civilian spheres. Also in 1922, Liu Xiang, who had become Sichuan governor, was defeated in a war against Xiong Kewu and Deng Xihou. Liu Wenhui moved his troops to Chongqing to support his nephew, but after Liu Xiang's defeat, he negotiated a withdrawal back to Yibin to avoid the loss of his army. Liu Xiang was subsequently forced to resign his position as governor. From 1922 to 1924, there was constant conflict in Sichuan. According to historian Robert Kapp, the region functioned as a politically isolated ecosystem for much of the early Republican period. Because it was insulated by geography from the rest of China, this allowed a highly fragmented and fluid balance of power to emerge against local warlords. Outside powers, including Wu Peifu of the Zhili Clique and Sun Yat-sen of the Kuomintang, also intervened intermittently in the Sichuan melee to support their chosen side in the larger context of the North-South conflict. Liu Wenhui was generally aligned with Liu Xiang and Liu Chengxun during this period, being promoted to commander of the Ninth Division in February 1923 by Liu Chengxun.
=== Phimosis, balanitis and balanoposthitis === Phimosis is the inability to retract the foreskin over the glans penis. At birth, the foreskin cannot be retracted due to adhesions between the foreskin and glans, and this is considered normal (physiological phimosis). Over time the foreskin naturally separates from the glans, and a majority of boys are able to retract the foreskin by age three. Less than one percent are still having problems at age 18. If the inability to do so becomes problematic (pathological phimosis) circumcision is a treatment option. A preputioplasty, where the foreskin is surgically widened instead of removed, is another possible surgical treatment option for phimosis. This pathological phimosis may be due to scarring from the skin disease balanitis xerotica obliterans (BXO), repeated episodes of balanoposthitis or forced retraction of the foreskin. Steroid creams are also a reasonable option and may prevent the need for surgery including in those with mild BXO. The procedure may also be used to prevent the development of phimosis. Phimosis is also a complication that can result from circumcision. An inflammation of the glans penis and foreskin is called balanoposthitis, and the condition affecting the glans alone is called balanitis. Most cases of these conditions occur in uncircumcised males, affecting 4–11% of that group. The moist, warm space underneath the foreskin is thought to facilitate the growth of pathogens, particularly when hygiene is poor.
I would guess if we had gone in there, we would still have forces in Baghdad today. We'd be running the country. We would not have been able to get everybody out and bring everybody home. And the final point that I think needs to be made is this question of casualties. I don't think you could have done all of that without significant additional US casualties, and while everybody was tremendously impressed with the low cost of the conflict, for the 146 Americans who were killed in action and for their families, it wasn't a cheap war.
Sources: en.wikipedia.org
Short transit at ambient temperature is generally tolerated, but long-term storage at room temperature is not recommended. Heat, moisture, and light all accelerate degradation. Cold, dry, dark storage is the conventional choice.
Suppliers typically quote a percentage derived from reverse-phase HPLC peak area. That figure reflects the relative amount of the main peak and does not by itself confirm identity or exclude related impurities. Mass spectrometry is commonly paired with it for confirmation.
Peptides purified by reverse-phase chromatography often carry trifluoroacetate as a counter-ion, which adds mass and can affect solubility and apparent behavior in assays. Acetate and hydrochloride forms are also offered. Knowing which form is present matters when calculating how much peptide a given weight contains.
No. Thymosin beta-4 is a 43-residue natural peptide, while TB-500 is a commercial label applied to a short synthetic fragment of it. The two differ in length, sequence coverage and how they are handled in the laboratory.